Lineage for d1mbg__ (1mbg -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351237Superfamily a.4.1: Homeodomain-like [46689] (12 families) (S)
    consists only of helices
  5. 351392Family a.4.1.3: Myb/SANT domain [46739] (5 proteins)
  6. 351397Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 351398Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 351411Domain d1mbg__: 1mbg - [16033]
    repeat 2
    complexed with nh2

Details for d1mbg__

PDB Entry: 1mbg (more details)

PDB Description: mouse c-myb dna-binding domain repeat 2

SCOP Domain Sequences for d1mbg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbg__ a.4.1.3 (-) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
likgpwtkeedqrvielvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe

SCOP Domain Coordinates for d1mbg__:

Click to download the PDB-style file with coordinates for d1mbg__.
(The format of our PDB-style files is described here.)

Timeline for d1mbg__: