Lineage for d1idza_ (1idz A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1477818Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1477826Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 1477827Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 1477842Domain d1idza_: 1idz A: [16032]
    repeat 3

Details for d1idza_

PDB Entry: 1idz (more details)

PDB Description: structure of myb transforming protein, nmr, 20 structures
PDB Compounds: (A:) mouse c-myb DNA-binding domain repeat 3

SCOPe Domain Sequences for d1idza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idza_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
mevkktswteeedrilyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv

SCOPe Domain Coordinates for d1idza_:

Click to download the PDB-style file with coordinates for d1idza_.
(The format of our PDB-style files is described here.)

Timeline for d1idza_: