PDB entry 1idz

View 1idz on RCSB PDB site
Description: structure of myb transforming protein, nmr, 20 structures
Class: DNA-binding protein
Keywords: protooncogene product, DNA-binding protein
Deposited on 1996-08-15, released 1996-12-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mouse c-myb DNA-binding domain repeat 3
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06876 (1-53)
    • engineered (15)
  Domains in SCOPe 2.04: d1idza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1idzA (A:)
  mevkktswteeedrilyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv