SCOPe 2.05: Domain d1lfba_: 1lfb A:

Lineage for d1lfba_ (1lfb A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [46697] (2 species)
   atypical Homeodomain with a large insertion into HTH motif

7. Species Rat (Rattus rattus) [TaxId:10117] [46698] (2 PDB entries)

8. Domain d1lfba_: 1lfb A: [15989]

Details for d1lfba_

PDB Entry: 1lfb, 2.8 Å

PDB Description: the x-ray structure of an atypical homeodomain present in the rat liver transcription factor lfb1(slash)hnf1 and implications for dna binding

PDB Compounds: (A:) liver transcription factor (lfb1)

SCOPe Domain Sequences for d1lfba_:

Sequence; same for both SEQRES and ATOM records:

>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]}
rfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsqaqglgsnlvtev
rvynwfanrrkeeafrhk

Timeline for d1lfba_:

• d1lfba_ first appeared (with stable ids) in SCOP 1.55, called d1lfb__
  
• d1lfba_ appears in SCOPe 2.04
  
• d1lfba_ appears in SCOPe 2.06
  
• d1lfba_ appears in the current release, SCOPe 2.08