PDB entry 1lfb

View 1lfb on RCSB PDB site
Description: the x-ray structure of an atypical homeodomain present in the rat liver transcription factor lfb1(slash)hnf1 and implications for DNA binding
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1993-06-28, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: liver transcription factor (lfb1)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22361
  Domains in SCOPe 2.05: d1lfba_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1lfbA (A:)
  aridptkkgrrnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsq
  aqglgsnlvtevrvynwfanrrkeeafrhklamdtykln
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1lfbA (A:)
  rfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsqaqglgsnlvtev
  rvynwfanrrkeeafrhk