Lineage for d1fcdc1 (1fcd C:1-80)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 905154Family a.3.1.4: Two-domain cytochrome c [46680] (2 proteins)
    duplication: consists of two cytochrome c type domains
  6. 905182Protein Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit [46683] (1 species)
  7. 905183Species Chromatium vinosum [TaxId:1049] [46684] (1 PDB entry)
  8. 905184Domain d1fcdc1: 1fcd C:1-80 [15966]
    Other proteins in same PDB: d1fcda1, d1fcda2, d1fcda3, d1fcdb1, d1fcdb2, d1fcdb3
    complexed with fad, hem

Details for d1fcdc1

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution
PDB Compounds: (C:) flavocytochrome c sulfide dehydrogenase (cytochrome subunit)

SCOPe Domain Sequences for d1fcdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcdc1 a.3.1.4 (C:1-80) Flavocytochrome c sulfide dehydrogenase, FCSD, cytochrome subunit {Chromatium vinosum [TaxId: 1049]}
eptaemltnncagchgthgnsvgpaspsiaqmdpmvfvevmegfksgeiastimgriakg
ystadfekmagyfkqqtyqp

SCOPe Domain Coordinates for d1fcdc1:

Click to download the PDB-style file with coordinates for d1fcdc1.
(The format of our PDB-style files is described here.)

Timeline for d1fcdc1: