Lineage for d2bccd2 (2bcc D:1-195)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the core
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) Protein Cytochrome bc1 domain [46677] (4 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [46679] (3 PDB entries) 
Domain d2bccd2: 2bcc D:1-195 [15960]
Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_
complexed with bog, fes, hem, pee, sig, u10
Details for d2bccd2
PDB Entry: 2bcc (more details), 3.5 Å
PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (D:) ubiquinol cytochrome c oxidoreductaseSCOPe Domain Sequences for d2bccd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bccd2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Chicken (Gallus gallus) [TaxId: 9031]}
sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
qvakdvctflrwaae
SCOPe Domain Coordinates for d2bccd2:
Click to download the PDB-style file with coordinates for d2bccd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bccd2:
View in 3D
