![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries) |
![]() | Domain d2bccc2: 2bcc C:262-380 [75987] Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_ complexed with bog, fes, hem, pee, sig, u10 |
PDB Entry: 2bcc (more details), 3.5 Å
SCOPe Domain Sequences for d2bccc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bccc2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny
Timeline for d2bccc2: