SCOPe 2.07: Domain d1aofa1: 1aof A:36-133

Lineage for d1aofa1 (1aof A:36-133)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
   formerly Thiosphaera pantotropha

8. Domain d1aofa1: 1aof A:36-133 [15937]
   Other proteins in same PDB: d1aofa2, d1aofb2
   complexed with dhe, hem, so2

Details for d1aofa1

PDB Entry: 1aof, 2 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1aofa1:

Sequence; same for both SEQRES and ATOM records:

>d1aofa1 a.3.1.2 (A:36-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
dvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylq
sfityaspagmpnwgtsgelsaeqvdlmanyllldpaa

Timeline for d1aofa1:

• d1aofa1 first appeared (with stable ids) in SCOP 1.55
  
• d1aofa1 appears in SCOPe 2.06
  
• d1aofa1 appears in the current release, SCOPe 2.08