Lineage for d1aofa1 (1aof A:36-133)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691393Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 2691394Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 2691400Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
    formerly Thiosphaera pantotropha
  8. 2691408Domain d1aofa1: 1aof A:36-133 [15937]
    Other proteins in same PDB: d1aofa2, d1aofb2
    complexed with dhe, hem, so2

Details for d1aofa1

PDB Entry: 1aof (more details), 2 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d1aofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aofa1 a.3.1.2 (A:36-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
dvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylq
sfityaspagmpnwgtsgelsaeqvdlmanyllldpaa

SCOPe Domain Coordinates for d1aofa1:

Click to download the PDB-style file with coordinates for d1aofa1.
(The format of our PDB-style files is described here.)

Timeline for d1aofa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aofa2