Lineage for d1c7ma_ (1c7m A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078002Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1078003Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1078004Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1078093Protein Cytochrome c552 [46636] (5 species)
  7. 1078105Species Paracoccus denitrificans [TaxId:266] [46639] (5 PDB entries)
  8. 1078116Domain d1c7ma_: 1c7m A: [15830]
    complexed with hec

Details for d1c7ma_

PDB Entry: 1c7m (more details)

PDB Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state
PDB Compounds: (A:) protein (cytochrome c552)

SCOPe Domain Sequences for d1c7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ma_ a.3.1.1 (A:) Cytochrome c552 {Paracoccus denitrificans [TaxId: 266]}
madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
alqefltnpkavvkgtkmafaglpkiedranliaylegqq

SCOPe Domain Coordinates for d1c7ma_:

Click to download the PDB-style file with coordinates for d1c7ma_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ma_: