Lineage for d1c7ma_ (1c7m A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1028Protein Cytochrome c552 [46636] (5 species)
  7. 1034Species Paracoccus denitrificans [TaxId:266] [46639] (3 PDB entries)
  8. 1043Domain d1c7ma_: 1c7m A: [15830]

Details for d1c7ma_

PDB Entry: 1c7m (more details)

PDB Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state

SCOP Domain Sequences for d1c7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ma_ a.3.1.1 (A:) Cytochrome c552 {Paracoccus denitrificans}
madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
alqefltnpkavvkgtkmafaglpkiedranliaylegqq

SCOP Domain Coordinates for d1c7ma_:

Click to download the PDB-style file with coordinates for d1c7ma_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ma_: