Lineage for d3ethb3 (3eth B:79-276)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219586Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1219587Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1219607Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 1219738Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 [56072] (1 species)
  7. 1219739Species Escherichia coli [TaxId:562] [56073] (4 PDB entries)
  8. 1219743Domain d3ethb3: 3eth B:79-276 [158203]
    Other proteins in same PDB: d3etha1, d3etha2, d3ethb1, d3ethb2
    automatically matched to d1b6ra3
    complexed with atp, mg

Details for d3ethb3

PDB Entry: 3eth (more details), 1.6 Å

PDB Description: crystal structure of e. coli purk in complex with mgatp
PDB Compounds: (B:) Phosphoribosylaminoimidazole carboxylase ATPase subunit

SCOPe Domain Sequences for d3ethb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ethb3 d.142.1.2 (B:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]}
drltqkqlfdklhlptapwqllaersewpavfdrlgelaivkrrtggydgrgqwrlrane
teqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlhqdgilrtsvafpqa
naqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvhnsghwtqngasisq
felhlraitdlplpqpvv

SCOPe Domain Coordinates for d3ethb3:

Click to download the PDB-style file with coordinates for d3ethb3.
(The format of our PDB-style files is described here.)

Timeline for d3ethb3: