Lineage for d3ethb1 (3eth B:277-355)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139355Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1139429Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 1139430Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 1139479Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)
  7. 1139480Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)
  8. 1139484Domain d3ethb1: 3eth B:277-355 [158201]
    Other proteins in same PDB: d3etha2, d3etha3, d3ethb2, d3ethb3
    automatically matched to d1b6ra1
    complexed with atp, mg

Details for d3ethb1

PDB Entry: 3eth (more details), 1.6 Å

PDB Description: crystal structure of e. coli purk in complex with mgatp
PDB Compounds: (B:) Phosphoribosylaminoimidazole carboxylase ATPase subunit

SCOPe Domain Sequences for d3ethb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ethb1 b.84.2.1 (B:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

SCOPe Domain Coordinates for d3ethb1:

Click to download the PDB-style file with coordinates for d3ethb1.
(The format of our PDB-style files is described here.)

Timeline for d3ethb1: