Class a: All alpha proteins [46456] (284 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein Acyl carrier protein [47338] (6 species) |
Species Escherichia coli [TaxId:562] [47339] (10 PDB entries) Uniprot P02901 |
Domain d3ejeg1: 3eje G:21-92 [158179] Other proteins in same PDB: d3ejeb_, d3ejed_, d3ejef_, d3ejeh_ automatically matched to d1acpa_ complexed with hem, htg, zmo |
PDB Entry: 3eje (more details), 2.1 Å
SCOPe Domain Sequences for d3ejeg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejeg1 a.28.1.1 (G:21-92) Acyl carrier protein {Escherichia coli [TaxId: 562]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyi
Timeline for d3ejeg1: