SCOPe 2.08: Domain d3ejeg2: 3eje G:20-92

Lineage for d3ejeg2 (3eje G:20-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein Acyl carrier protein [47338] (7 species)

7. Species Escherichia coli [TaxId:562] [47339] (26 PDB entries)
   Uniprot P02901

8. Domain d3ejeg2: 3eje G:20-92 [158179]
   Other proteins in same PDB: d3ejea3, d3ejeb_, d3ejec3, d3ejed_, d3ejee3, d3ejef_, d3ejeg3, d3ejeh_
   automated match to d1t8ka_
   complexed with hem, htg, zmo

Details for d3ejeg2

PDB Entry: 3eje, 2.1 Å

PDB Description: crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein

PDB Compounds: (G:) Acyl carrier protein

SCOPe Domain Sequences for d3ejeg2:

Sequence; same for both SEQRES and ATOM records:

>d3ejeg2 a.28.1.1 (G:20-92) Acyl carrier protein {Escherichia coli [TaxId: 562]}
mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
ekittvqaaidyi

Timeline for d3ejeg2:

• d3ejeg2 first appeared in SCOP 1.75, called d3ejeg1
  
• d3ejeg2 appears in SCOPe 2.07