SCOPe 2.07: Domain d3ecgb_: 3ecg B:

Lineage for d3ecgb_ (3ecg B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species)

7. Species Human immunodeficiency virus type 2 (isolate rod) [TaxId:11720] [187235] (3 PDB entries)

8. Domain d3ecgb_: 3ecg B: [158099]
   automated match to d1hiia_
   complexed with 065, cl, imd, na, zn

Details for d3ecgb_

PDB Entry: 3ecg, 1.18 Å

PDB Description: High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-98065

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3ecgb_:

Sequence; same for both SEQRES and ATOM records:

>d3ecgb_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 (isolate rod) [TaxId: 11720]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d3ecgb_:

• d3ecgb_ first appeared in SCOP 1.75, called d3ecgb1
  
• d3ecgb_ appears in SCOPe 2.06
  
• d3ecgb_ appears in the current release, SCOPe 2.08