Lineage for d1c6ra_ (1c6r A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 904839Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)
  7. 904866Species Green alga (Scenedesmus obliquus) [TaxId:3088] [46635] (2 PDB entries)
  8. 904867Domain d1c6ra_: 1c6r A: [15807]
    complexed with cd, hem

Details for d1c6ra_

PDB Entry: 1c6r (more details), 1.9 Å

PDB Description: crystal structure of reduced cytochrome c6 from the green algae scenedesmus obliquus
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1c6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6ra_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Scenedesmus obliquus) [TaxId: 3088]}
adlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkgam
pawsgtldddeiaavaayvydqasgdkw

SCOPe Domain Coordinates for d1c6ra_:

Click to download the PDB-style file with coordinates for d1c6ra_.
(The format of our PDB-style files is described here.)

Timeline for d1c6ra_: