| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (11 species) |
| Species Green alga (Scenedesmus obliquus) [TaxId:3088] [46635] (2 PDB entries) |
| Domain d1c6ra_: 1c6r A: [15807] complexed with cd, hem |
PDB Entry: 1c6r (more details), 1.9 Å
SCOPe Domain Sequences for d1c6ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c6ra_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Green alga (Scenedesmus obliquus) [TaxId: 3088]}
adlalgkqtfeancaachaggnnsvipdhtlrkaameqflqggfnleaityqvengkgam
pawsgtldddeiaavaayvydqasgdkw
Timeline for d1c6ra_: