| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
| Protein Cambialistic superoxide dismutase [46622] (2 species) active with either Fe or Mn |
| Species Porphyromonas gingivalis [TaxId:837] [46624] (3 PDB entries) Uniprot P19665 |
| Domain d1qnna1: 1qnn A:1-84 [15792] Other proteins in same PDB: d1qnna2, d1qnnb2, d1qnnc2, d1qnnd2 complexed with fe |
PDB Entry: 1qnn (more details), 1.8 Å
SCOPe Domain Sequences for d1qnna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnna1 a.2.11.1 (A:1-84) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
eggifnnagqtlnhnlyftqfrpg
Timeline for d1qnna1: