![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Cambialistic superoxide dismutase [54732] (2 species) active with either fe or mn |
![]() | Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries) Uniprot P19665 |
![]() | Domain d1qnnd2: 1qnn D:85-191 [38758] Other proteins in same PDB: d1qnna1, d1qnnb1, d1qnnc1, d1qnnd1 complexed with fe |
PDB Entry: 1qnn (more details), 1.8 Å
SCOPe Domain Sequences for d1qnnd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnnd2 d.44.1.1 (D:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn pvrkglnpllgfdvwehayyltyqnrradhlkdlwsivdwdivesry
Timeline for d1qnnd2: