Lineage for d3duhb2 (3duh B:88-211)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372146Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 2372147Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)
  8. 2372152Domain d3duhb2: 3duh B:88-211 [157886]
    Other proteins in same PDB: d3duha1, d3duha4, d3duhb1, d3duhb4
    automatically matched to d1f42a2
    complexed with nag

Details for d3duhb2

PDB Entry: 3duh (more details), 2.3 Å

PDB Description: structure of interleukin-23
PDB Compounds: (B:) Interleukin-12 subunit beta

SCOPe Domain Sequences for d3duhb2:

Sequence, based on SEQRES records: (download)

>d3duhb2 b.1.2.1 (B:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffi
rdii

Sequence, based on observed residues (ATOM records): (download)

>d3duhb2 b.1.2.1 (B:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaenkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdii

SCOPe Domain Coordinates for d3duhb2:

Click to download the PDB-style file with coordinates for d3duhb2.
(The format of our PDB-style files is described here.)

Timeline for d3duhb2: