| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries) |
| Domain d3duhb2: 3duh B:88-211 [157886] Other proteins in same PDB: d3duha1, d3duha4, d3duhb1, d3duhb4 automatically matched to d1f42a2 complexed with nag |
PDB Entry: 3duh (more details), 2.3 Å
SCOPe Domain Sequences for d3duhb2:
Sequence, based on SEQRES records: (download)
>d3duhb2 b.1.2.1 (B:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffi
rdii
>d3duhb2 b.1.2.1 (B:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaenkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdii
Timeline for d3duhb2:
View in 3DDomains from other chains: (mouse over for more information) d3duha1, d3duha2, d3duha3, d3duha4 |