SCOPe 2.04: Domain d3dugb2: 3dug B:57-359

Lineage for d3dugb2 (3dug B:57-359)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins)
   automatically mapped to Pfam PF01979

6. Protein Zn-dependent arginine carboxypeptidase [159411] (1 species)

7. Species Unidentified organism [TaxId:32644] [159412] (2 PDB entries)

8. Domain d3dugb2: 3dug B:57-359 [157869]
   Other proteins in same PDB: d3duga1, d3dugb1, d3dugc1, d3dugd1, d3duge1, d3dugf1, d3dugg1, d3dugh1
   automatically matched to 3BE7 A:57-359
   complexed with arg, gol, zn

Details for d3dugb2

PDB Entry: 3dug, 2.62 Å

PDB Description: crystal structure of zn-dependent arginine carboxypeptidase complexed with zinc

PDB Compounds: (B:) Zn-dependent arginine carboxypeptidase

SCOPe Domain Sequences for d3dugb2:

Sequence; same for both SEQRES and ATOM records:

>d3dugb2 c.1.9.18 (B:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
glmdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvr
daiergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrky
gadlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaika
gvdsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkq
renfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgie
nig

Timeline for d3dugb2:

• d3dugb2 first appeared in SCOP 1.75
  
• d3dugb2 appears in SCOPe 2.03
  
• d3dugb2 appears in SCOPe 2.05
  
• d3dugb2 appears in the current release, SCOPe 2.08