SCOP 1.67: Domain d3mdsb1: 3mds B:1-92

Lineage for d3mdsb1 (3mds B:1-92)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)

7. Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries)

8. Domain d3mdsb1: 3mds B:1-92 [15779]
   Other proteins in same PDB: d3mdsa2, d3mdsb2
   complexed with mn; mutant

Details for d3mdsb1

PDB Entry: 3mds, 1.8 Å

PDB Description: maganese superoxide dismutase from thermus thermophilus

SCOP Domain Sequences for d3mdsb1:

Sequence; same for both SEQRES and ATOM records:

>d3mdsb1 a.2.11.1 (B:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus}
pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
hlaalpqdiqtavrnnggghlnhslfwrlltp

Timeline for d3mdsb1:

• d3mdsb1 first appeared (with stable ids) in SCOP 1.55
  
• d3mdsb1 appears in SCOP 1.65
  
• d3mdsb1 appears in SCOP 1.69
  
• d3mdsb1 appears in the current release, SCOPe 2.08