Lineage for d3mdsb2 (3mds B:93-203)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411078Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 411079Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 411080Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 411184Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 411259Species Thermus thermophilus [TaxId:274] [54723] (2 PDB entries)
  8. 411263Domain d3mdsb2: 3mds B:93-203 [38704]
    Other proteins in same PDB: d3mdsa1, d3mdsb1
    complexed with mn; mutant

Details for d3mdsb2

PDB Entry: 3mds (more details), 1.8 Å

PDB Description: maganese superoxide dismutase from thermus thermophilus

SCOP Domain Sequences for d3mdsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdsb2 d.44.1.1 (B:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus}
ggakepvgelkkaideqfggfqalkekltqaamgrfgsgwawlvkdpfgklhvlstpnqd
npvmegftpivgidvwehayylkyqnrradylqaiwnvlnwdvaeeffkka

SCOP Domain Coordinates for d3mdsb2:

Click to download the PDB-style file with coordinates for d3mdsb2.
(The format of our PDB-style files is described here.)

Timeline for d3mdsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mdsb1