Lineage for d1mngb1 (1mng B:1-92)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209616Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 209725Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 209726Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 209802Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 209869Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries)
  8. 209871Domain d1mngb1: 1mng B:1-92 [15777]
    Other proteins in same PDB: d1mnga2, d1mngb2
    complexed with azi, mn; mutant

Details for d1mngb1

PDB Entry: 1mng (more details), 1.8 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus

SCOP Domain Sequences for d1mngb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mngb1 a.2.11.1 (B:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus}
pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
hlaalpqdiqtavrnnggghlnhslfwrlltp

SCOP Domain Coordinates for d1mngb1:

Click to download the PDB-style file with coordinates for d1mngb1.
(The format of our PDB-style files is described here.)

Timeline for d1mngb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mngb2