| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
| Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries) |
| Domain d1mngb1: 1mng B:1-92 [15777] Other proteins in same PDB: d1mnga2, d1mngb2 complexed with azi, mn |
PDB Entry: 1mng (more details), 1.8 Å
SCOPe Domain Sequences for d1mngb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mngb1 a.2.11.1 (B:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]}
pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
hlaalpqdiqtavrnnggghlnhslfwrlltp
Timeline for d1mngb1: