Lineage for d3dhwh2 (3dhw H:241-343)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863190Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 863357Family d.58.18.13: NIL domain-like [160322] (2 proteins)
    Pfam PF09383
  6. 863358Protein Methionine import ATP-binding protein MetN [160323] (2 species)
  7. 863359Species Escherichia coli [TaxId:562] [160325] (2 PDB entries)
    Uniprot P30750 241-343! Uniprot P30750 247-343
  8. 863365Domain d3dhwh2: 3dhw H:241-343 [157738]
    Other proteins in same PDB: d3dhwa1, d3dhwb1, d3dhwc1, d3dhwd1, d3dhwe1, d3dhwf1, d3dhwg1, d3dhwh1
    automatically matched to 3DHW C:241-343

Details for d3dhwh2

PDB Entry: 3dhw (more details), 3.7 Å

PDB Description: Crystal structure of methionine importer MetNI
PDB Compounds: (H:) Methionine import ATP-binding protein metN

SCOP Domain Sequences for d3dhwh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhwh2 d.58.18.13 (H:241-343) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
iqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaq
mdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv

SCOP Domain Coordinates for d3dhwh2:

Click to download the PDB-style file with coordinates for d3dhwh2.
(The format of our PDB-style files is described here.)

Timeline for d3dhwh2: