Lineage for d3dhwe1 (3dhw E:6-208)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888600Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 888601Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 888602Family f.58.1.1: MetI-like [161099] (5 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 888603Protein D-methionine transport system permease protein MetI [161108] (1 species)
    Synonym: YaeE
  7. 888604Species Escherichia coli [TaxId:562] [161109] (1 PDB entry)
    Uniprot P31547 6-208
  8. 888607Domain d3dhwe1: 3dhw E:6-208 [157733]
    Other proteins in same PDB: d3dhwc1, d3dhwc2, d3dhwd1, d3dhwd2, d3dhwg1, d3dhwg2, d3dhwh1, d3dhwh2
    automatically matched to 3DHW A:6-208

Details for d3dhwe1

PDB Entry: 3dhw (more details), 3.7 Å

PDB Description: Crystal structure of methionine importer MetNI
PDB Compounds: (E:) D-methionine transport system permease protein metI

SCOP Domain Sequences for d3dhwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhwe1 f.58.1.1 (E:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]}
mwllvrgvwetlamtfvsgffgfviglpvgvllyvtrpgqiianaklyrtvsaivnifrs
ipfiillvwmipftrvivgtsiglqaaivpltvgaapfiarmvenalleiptglieasra
mgatpmqivrkvllpealpglvnaatitlitlvgysamggavgagglgqigyqygyigyn
atvmntvlvllvilvyliqfagd

SCOP Domain Coordinates for d3dhwe1:

Click to download the PDB-style file with coordinates for d3dhwe1.
(The format of our PDB-style files is described here.)

Timeline for d3dhwe1: