![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.13: NIL domain-like [160322] (2 proteins) Pfam PF09383 |
![]() | Protein Methionine import ATP-binding protein MetN [160323] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160325] (3 PDB entries) Uniprot P30750 241-343! Uniprot P30750 247-343 |
![]() | Domain d3dhwh2: 3dhw H:241-343 [157738] Other proteins in same PDB: d3dhwa1, d3dhwb1, d3dhwc1, d3dhwd1, d3dhwe1, d3dhwf1, d3dhwg1, d3dhwh1 automatically matched to 3DHW C:241-343 |
PDB Entry: 3dhw (more details), 3.7 Å
SCOPe Domain Sequences for d3dhwh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dhwh2 d.58.18.13 (H:241-343) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} iqstlhldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaq mdyaggvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyv
Timeline for d3dhwh2: