![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (3 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [159642] (29 PDB entries) Uniprot P0C018 1-117 |
![]() | Domain d3df4o1: 3df4 O:2-117 [157698] Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3df4 (more details), 3.5 Å
SCOPe Domain Sequences for d3df4o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df4o1 c.55.4.1 (O:2-117) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} dkksarirratrarrklqelgatrlvvhrtprhiyaqviapngsevlvaastvekaiaeq lkytgnkdaaaavgkavaeralekgikdvsfdrsgfqyhgrvqaladaareaglqf
Timeline for d3df4o1:
![]() Domains from other chains: (mouse over for more information) d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1 |