Lineage for d3df4i1 (3df4 I:73-141)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695443Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 2695452Domain d3df4i1: 3df4 I:73-141 [157691]
    Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d3df4i1

PDB Entry: 3df4 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3df4i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df4i1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d3df4i1:

Click to download the PDB-style file with coordinates for d3df4i1.
(The format of our PDB-style files is described here.)

Timeline for d3df4i1: