![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) ![]() automatically mapped to Pfam PF00573 |
![]() | Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
![]() | Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
![]() | Species Escherichia coli [TaxId:562] [159477] (29 PDB entries) Uniprot P60723 1-201 |
![]() | Domain d3df4e1: 3df4 E:1-201 [157685] Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn |
PDB Entry: 3df4 (more details), 3.5 Å
SCOPe Domain Sequences for d3df4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df4e1 c.22.1.1 (E:1-201) Ribosomal protein L4 {Escherichia coli [TaxId: 562]} melvlkdaqsaltvsettfgrdfnealvhqvvvayaagarqgtraqktraevtgsgkkpw rqkgtgrarsgsikspiwrsggvtfaarpqdhsqkvnkkmyrgalksilselvrqdrliv vekfsveapktkllaqklkdmaledvliitgeldenlflaarnlhkvdvrdatgidpvsl iafdkvvmtadavkqveemla
Timeline for d3df4e1:
![]() Domains from other chains: (mouse over for more information) d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1 |