Class a: All alpha proteins [46456] (202 folds) |
Fold a.2: Long alpha-hairpin [46556] (12 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (6 species) |
Species Escherichia coli [TaxId:562] [46620] (10 PDB entries) |
Domain d1vewd1: 1vew D:1-90 [15769] Other proteins in same PDB: d1vewa2, d1vewb2, d1vewc2, d1vewd2 complexed with mn, oh; mutant |
PDB Entry: 1vew (more details), 2.1 Å
SCOP Domain Sequences for d1vewd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vewd1 a.2.11.1 (D:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli} sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl dqlpadkktvlrnnagghanhslfwkglkk
Timeline for d1vewd1: