| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
| Species Escherichia coli [TaxId:562] [46620] (12 PDB entries) |
| Domain d1vewd1: 1vew D:1-90 [15769] Other proteins in same PDB: d1vewa2, d1vewb2, d1vewc2, d1vewd2 complexed with mn, oh |
PDB Entry: 1vew (more details), 2.1 Å
SCOPe Domain Sequences for d1vewd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vewd1 a.2.11.1 (D:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk
Timeline for d1vewd1: