Lineage for d3df1p1 (3df1 P:1-82)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900537Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1900538Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1900539Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1900540Protein Ribosomal protein S16 [54567] (3 species)
  7. 1900543Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 1900551Domain d3df1p1: 3df1 P:1-82 [157618]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1
    protein/RNA complex; complexed with hyg, mg
    protein/RNA complex; complexed with hyg, mg

Details for d3df1p1

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d3df1p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1p1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnkaa

SCOPe Domain Coordinates for d3df1p1:

Click to download the PDB-style file with coordinates for d3df1p1.
(The format of our PDB-style files is described here.)

Timeline for d3df1p1: