Lineage for d3df1r1 (3df1 R:19-73)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723549Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1723550Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1723551Protein Ribosomal protein S18 [46913] (2 species)
  7. 1723552Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 1723560Domain d3df1r1: 3df1 R:19-73 [157620]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1s1, d3df1t1, d3df1u1
    protein/RNA complex; complexed with hyg, mg
    protein/RNA complex; complexed with hyg, mg

Details for d3df1r1

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d3df1r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1r1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d3df1r1:

Click to download the PDB-style file with coordinates for d3df1r1.
(The format of our PDB-style files is described here.)

Timeline for d3df1r1: