Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (2 species) |
Species Escherichia coli [TaxId:562] [159644] (24 PDB entries) Uniprot P0A7R9 12-128 |
Domain d3df1k1: 3df1 K:12-128 [157613] Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1 protein/RNA complex; complexed with hyg, mg protein/RNA complex; complexed with hyg, mg |
PDB Entry: 3df1 (more details), 3.5 Å
SCOPe Domain Sequences for d3df1k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df1k1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
Timeline for d3df1k1: