Lineage for d1i0ha1 (1i0h A:1-90)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94371Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 94462Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 94463Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 94532Protein Mn superoxide dismutase (MnSOD) [46618] (4 species)
  7. 94538Species Escherichia coli [TaxId:562] [46620] (8 PDB entries)
  8. 94539Domain d1i0ha1: 1i0h A:1-90 [15760]
    Other proteins in same PDB: d1i0ha2, d1i0hb2

Details for d1i0ha1

PDB Entry: 1i0h (more details), 1.35 Å

PDB Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.

SCOP Domain Sequences for d1i0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ha1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOP Domain Coordinates for d1i0ha1:

Click to download the PDB-style file with coordinates for d1i0ha1.
(The format of our PDB-style files is described here.)

Timeline for d1i0ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0ha2