Lineage for d1i0ha1 (1i0h A:1-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690050Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2690176Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 2690201Species Escherichia coli [TaxId:562] [46620] (12 PDB entries)
  8. 2690206Domain d1i0ha1: 1i0h A:1-90 [15760]
    Other proteins in same PDB: d1i0ha2, d1i0hb2
    complexed with mn; mutant

Details for d1i0ha1

PDB Entry: 1i0h (more details), 1.35 Å

PDB Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
PDB Compounds: (A:) manganese superoxide dismutase y174f mutant

SCOPe Domain Sequences for d1i0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ha1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOPe Domain Coordinates for d1i0ha1:

Click to download the PDB-style file with coordinates for d1i0ha1.
(The format of our PDB-style files is described here.)

Timeline for d1i0ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0ha2