Class a: All alpha proteins [46456] (284 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family) Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats |
Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins) |
Protein Uncharacterized protein BCE_G9241_0798 [158434] (1 species) |
Species Bacillus cereus [TaxId:1396] [158435] (1 PDB entry) Uniprot Q4MWP8 125-259! Uniprot Q4MWP8 4-124 |
Domain d3dbyn1: 3dby N:5-125 [157512] automatically matched to 3DBY A:5-125 complexed with edo, fe |
PDB Entry: 3dby (more details), 2.1 Å
SCOPe Domain Sequences for d3dbyn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbyn1 a.29.13.1 (N:5-125) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]} nyeesalfehqfwlkvltdhaqflldalapkekedikkatyfvetftnllnkvrnvnlma fskeaeqaakeirafklniiqkqlegkitihftptfinhmvneveeyiavleflkkgevp p
Timeline for d3dbyn1:
View in 3D Domains from other chains: (mouse over for more information) d3dbya1, d3dbya2, d3dbyb1, d3dbyb2, d3dbyc1, d3dbyc2, d3dbyd1, d3dbyd2, d3dbye1, d3dbye2, d3dbyf1, d3dbyf2, d3dbyg1, d3dbyg2, d3dbyh1, d3dbyh2, d3dbyi1, d3dbyi2, d3dbyj1, d3dbyj2, d3dbyk1, d3dbyk2, d3dbyl1, d3dbyl2, d3dbym1, d3dbym2, d3dbyo1, d3dbyo2, d3dbyp1, d3dbyp2, d3dbyq1, d3dbyq2, d3dbyr1, d3dbyr2, d3dbys1, d3dbys2, d3dbyt1, d3dbyt2 |