SCOPe 2.01: Domain d3dbym1: 3dby M:5-125

Lineage for d3dbym1 (3dby M:5-125)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family)
   Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats

5. Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins)

6. Protein Uncharacterized protein BCE_G9241_0798 [158434] (1 species)

7. Species Bacillus cereus [TaxId:1396] [158435] (1 PDB entry)
   Uniprot Q4MWP8 125-259! Uniprot Q4MWP8 4-124

8. Domain d3dbym1: 3dby M:5-125 [157510]
   automatically matched to 3DBY A:5-125
   complexed with edo, fe

Details for d3dbym1

PDB Entry: 3dby, 2.1 Å

PDB Description: crystal structure of uncharacterized protein from bacillus cereus g9241 (csap target)

PDB Compounds: (M:) Uncharacterized protein

SCOPe Domain Sequences for d3dbym1:

Sequence; same for both SEQRES and ATOM records:

>d3dbym1 a.29.13.1 (M:5-125) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]}
nyeesalfehqfwlkvltdhaqflldalapkekedikkatyfvetftnllnkvrnvnlma
fskeaeqaakeirafklniiqkqlegkitihftptfinhmvneveeyiavleflkkgevp
p

Timeline for d3dbym1:

• d3dbym1 first appeared in SCOP 1.75
  
• d3dbym1 appears in SCOPe 2.02
  
• d3dbym1 appears in the current release, SCOPe 2.08