SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3d87b3 (3d87 B:212-305)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029815Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 2029816Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)
  8. 2029828Domain d3d87b3: 3d87 B:212-305 [157444]
    Other proteins in same PDB: d3d87b1, d3d87d1
    automatically matched to d1f42a3
    complexed with k, man, po4

Details for d3d87b3

PDB Entry: 3d87 (more details), 2.9 Å

PDB Description: Crystal structure of Interleukin-23
PDB Compounds: (B:) Interleukin-12 subunit p40

SCOPe Domain Sequences for d3d87b3:

Sequence, based on SEQRES records: (download)

>d3d87b3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpc

Sequence, based on observed residues (ATOM records): (download)

>d3d87b3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqdrvftdktsatvicr
knasisvraqdryyssswsewasvpc

SCOPe Domain Coordinates for d3d87b3:

Click to download the PDB-style file with coordinates for d3d87b3.
(The format of our PDB-style files is described here.)

Timeline for d3d87b3: