Lineage for d3d87b3 (3d87 B:212-305)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029815Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 2029816Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)
  8. 2029828Domain d3d87b3: 3d87 B:212-305 [157444]
    Other proteins in same PDB: d3d87b1, d3d87d1
    automatically matched to d1f42a3
    complexed with k, man, po4

Details for d3d87b3

PDB Entry: 3d87 (more details), 2.9 Å

PDB Description: Crystal structure of Interleukin-23
PDB Compounds: (B:) Interleukin-12 subunit p40

SCOPe Domain Sequences for d3d87b3:

Sequence, based on SEQRES records: (download)

>d3d87b3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpc

Sequence, based on observed residues (ATOM records): (download)

>d3d87b3 b.1.2.1 (B:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqdrvftdktsatvicr
knasisvraqdryyssswsewasvpc

SCOPe Domain Coordinates for d3d87b3:

Click to download the PDB-style file with coordinates for d3d87b3.
(The format of our PDB-style files is described here.)

Timeline for d3d87b3: