SCOPe 2.03: Domain d3d70a2: 3d70 A:121-277

Lineage for d3d70a2 (3d70 A:121-277)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
   duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)

4. Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (4 families)

5. Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (2 proteins)
   automatically mapped to Pfam PF06445

6. Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [55139] (9 PDB entries)
   Uniprot P39075

8. Domain d3d70a2: 3d70 A:121-277 [157417]
   Other proteins in same PDB: d3d70a1
   automatically matched to d1bowa_
   protein/DNA complex; complexed with gol, imd; mutant

Details for d3d70a2

PDB Entry: 3d70, 2.8 Å

PDB Description: crystal structure of e253a mutant of bmrr bound to 22-bp oligonucleotide

PDB Compounds: (A:) BMR promoter DNA

SCOPe Domain Sequences for d3d70a2:

Sequence; same for both SEQRES and ATOM records:

>d3d70a2 d.60.1.1 (A:121-277) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyaliipihyspkkqeeyrvemkiril

Timeline for d3d70a2:

• d3d70a2 first appeared in SCOP 1.75
  
• d3d70a2 appears in SCOPe 2.02
  
• d3d70a2 appears in SCOPe 2.04
  
• d3d70a2 appears in the current release, SCOPe 2.08