Lineage for d3d70a1 (3d70 A:3-120)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261200Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1261201Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1261232Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
    includes a dimerisation, antiparallel coiled-coil subdomain
  6. 1261238Protein Transcription activator BmrR [46963] (1 species)
    followed by long alpha-helical linker
  7. 1261239Species Bacillus subtilis [TaxId:1423] [46964] (7 PDB entries)
    Uniprot P39075
  8. 1261244Domain d3d70a1: 3d70 A:3-120 [157416]
    Other proteins in same PDB: d3d70a2
    automatically matched to d1exia1
    protein/DNA complex; complexed with gol, imd; mutant

Details for d3d70a1

PDB Entry: 3d70 (more details), 2.8 Å

PDB Description: crystal structure of e253a mutant of bmrr bound to 22-bp oligonucleotide
PDB Compounds: (A:) BMR promoter DNA

SCOPe Domain Sequences for d3d70a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d70a1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

SCOPe Domain Coordinates for d3d70a1:

Click to download the PDB-style file with coordinates for d3d70a1.
(The format of our PDB-style files is described here.)

Timeline for d3d70a1: