| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
| Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins) includes a dimerisation, antiparallel coiled-coil subdomain |
| Protein Transcription activator BmrR [46963] (1 species) followed by long alpha-helical linker |
| Species Bacillus subtilis [TaxId:1423] [46964] (7 PDB entries) Uniprot P39075 |
| Domain d3d70a1: 3d70 A:3-120 [157416] Other proteins in same PDB: d3d70a2 automatically matched to d1exia1 protein/DNA complex; complexed with gol, imd; mutant |
PDB Entry: 3d70 (more details), 2.8 Å
SCOPe Domain Sequences for d3d70a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d70a1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa
Timeline for d3d70a1: