Lineage for d3d70a2 (3d70 A:121-277)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864403Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 864404Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (4 families) (S)
  5. 864405Family d.60.1.1: Multidrug-binding domain of transcription activator BmrR [55137] (1 protein)
  6. 864406Protein Multidrug-binding domain of transcription activator BmrR [55138] (1 species)
  7. 864407Species Bacillus subtilis [TaxId:1423] [55139] (9 PDB entries)
    Uniprot P39075
  8. 864412Domain d3d70a2: 3d70 A:121-277 [157417]
    Other proteins in same PDB: d3d70a1
    automatically matched to d1bowa_
    complexed with gol, imd; mutant

Details for d3d70a2

PDB Entry: 3d70 (more details), 2.8 Å

PDB Description: crystal structure of e253a mutant of bmrr bound to 22-bp oligonucleotide
PDB Compounds: (A:) BMR promoter DNA

SCOP Domain Sequences for d3d70a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d70a2 d.60.1.1 (A:121-277) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyaliipihyspkkqeeyrvemkiril

SCOP Domain Coordinates for d3d70a2:

Click to download the PDB-style file with coordinates for d3d70a2.
(The format of our PDB-style files is described here.)

Timeline for d3d70a2: