Lineage for d3d5ah1 (3d5a H:1-138)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217010Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2217011Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2217012Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2217013Protein Ribosomal protein S8 [56049] (4 species)
  7. 2217031Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2217060Domain d3d5ah1: 3d5a H:1-138 [157342]
    Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1
    complexed with mg, zn
    complexed with mg, zn

Details for d3d5ah1

PDB Entry: 3d5a (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d3d5ah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ah1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d3d5ah1:

Click to download the PDB-style file with coordinates for d3d5ah1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ah1: