Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
Domain d3d5ah1: 3d5a H:1-138 [157342] Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1 automatically matched to d1fjgh_ complexed with mg, zn |
PDB Entry: 3d5a (more details), 3.21 Å
SCOP Domain Sequences for d3d5ah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5ah1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d3d5ah1: