Lineage for d3d4va1 (3d4v A:100-282)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721021Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2721022Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 2721023Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
    Uniprot P04395
  8. 2721058Domain d3d4va1: 3d4v A:100-282 [157302]
    Other proteins in same PDB: d3d4va2, d3d4vb2, d3d4vc2, d3d4vd2
    automated match to d1mpga1
    protein/DNA complex

Details for d3d4va1

PDB Entry: 3d4v (more details), 2.9 Å

PDB Description: crystal structure of an alka host/guest complex n7methylguanine:cytosine base pair
PDB Compounds: (A:) DNA-3-methyladenine glycosylase 2

SCOPe Domain Sequences for d3d4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d4va1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOPe Domain Coordinates for d3d4va1:

Click to download the PDB-style file with coordinates for d3d4va1.
(The format of our PDB-style files is described here.)

Timeline for d3d4va1: